PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g031890.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family MIKC_MADS
Protein Properties Length: 333aa    MW: 38124.7 Da    PI: 5.7746
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g031890.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF901.2e-28958150
                      S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
            SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                      k+ien++nrqvtfskRrng++KKA+ELSvLCd++va+i+fs++g++ ++s
  Sopen04g031890.1  9 KKIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRVSTFS 58
                      68***********************************************8 PP

2K-box18.39.4e-08109173974
             K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnelll 74 
                         +++ e+ qqe+ + k ++e ++r +R + G+  e  ++ e q  e+ L++ lk++ ++K+ +l 
  Sopen04g031890.1 109 SVDSHIEEFQQEIIRYKTQVEDMERRLRMYEGDFCEITTVCEAQYREEILQETLKQVQARKQ-VLE 173
                       568899******************************************************95.444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.857161IPR002100Transcription factor, MADS-box
SMARTSM004323.5E-38160IPR002100Transcription factor, MADS-box
CDDcd002656.65E-39275No hitNo description
SuperFamilySSF554551.7E-30282IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-25323IPR002100Transcription factor, MADS-box
PfamPF003196.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-253859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MGRVKLQIKK IENTTNRQVT FSKRRNGLIK KAYELSVLCD VDVALIMFSP SGRVSTFSGN  60
KSIEDIMARY VNLPEHDRGR LHNQEHLQRA IAKLKCEADR TYQAPSPSSV DSHIEEFQQE  120
IIRYKTQVED MERRLRMYEG DFCEITTVCE AQYREEILQE TLKQVQARKQ VLEENYHSPQ  180
TQNTTQPQMD FSGQNVNMVN NVATSDAIAN SSFMDWVPHS QRDPHVQILN FLDSNGLLPF  240
RDEADQHMLP PSLNQLHGVN VPAGTDHLSP NSRFDQNNPP RPSSFDGIID VNNAPWPPLY  300
TTGDDPFPVS QPRERAILEL FLSQLTPVNQ DHI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-16189190Myocyte-specific enhancer factor 2B
1tqe_Q4e-16189190Myocyte-specific enhancer factor 2B
1tqe_R4e-16189190Myocyte-specific enhancer factor 2B
1tqe_S4e-16189190Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754431e-100HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015073130.10.0PREDICTED: agamous-like MADS-box protein AGL104 isoform X2
SwissprotQ9LM461e-54AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLK4BUR70.0K4BUR7_SOLLC; Uncharacterized protein
STRINGSolyc04g078300.2.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.16e-56AGAMOUS-like 104